Structure of PDB 6lsr Chain a

Receptor sequence

>6lsra (length=145) Species: 9606 (Homo sapiens) [Search protein sequence]

SMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLII
RKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMRI
LRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLK

3D structure

PDB

6lsr Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.

Chain

Resolution

3.13 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	M3 R5 K8 R9 G18 K19 K20 K21 W23 L24 P26 S37 R38 R42 K46 V55 T56 H58 S59 R60 A61 R62 C63 R64 R71 R74 H75 M76 G77 G79 R81 K82 G83 T84 A87 R88 P90 K92 V93 W95 M96 R97 R100 R103 R104 R108 R110 R117 H118 Y120 H121 Y124 L125 K128 G129 N130 N134 K135 R136	M2 R4 K7 R8 G17 K18 K19 K20 W22 L23 P25 S36 R37 R41 K45 V54 T55 H57 S58 R59 A60 R61 C62 R63 R70 R73 H74 M75 G76 G78 R80 K81 G82 T83 A86 R87 P89 K91 V92 W94 M95 R96 R99 R102 R103 R107 R109 R116 H117 Y119 H120 Y123 L124 K127 G128 N129 N133 K134 R135
BS02	MG	a	Q39 R42	Q38 R41

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6lsr, PDBe:6lsr, PDBj:6lsr
PDBsum	6lsr
PubMed	32669547
UniProt	P84098\|RL19_HUMAN Large ribosomal subunit protein eL19 (Gene Name=RPL19)