Structure of PDB 6la2 Chain a

Receptor sequence

>6la2a (length=103) Species: 9606 (Homo sapiens) [Search protein sequence]

TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILEL
AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVL
LPK

3D structure

PDB

6la2 Engineering nucleosomes for generating diverse chromatin assemblies.

Chain

Resolution

3.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	a	R17 R20 R29 R32 R42 R77	R2 R5 R14 R17 R27 R62
BS02	dna	a	R29 R42 V43 K75 T76 R77	R14 R27 V28 K60 T61 R62

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0006325	chromatin organization
GO:0008285	negative regulation of cell population proliferation
GO:0031507	heterochromatin formation
GO:0061644	protein localization to CENP-A containing chromatin

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005694	chromosome
GO:0043505	CENP-A containing nucleosome
GO:0070062	extracellular exosome

External links

PDB	RCSB:6la2, PDBe:6la2, PDBj:6la2
PDBsum	6la2
PubMed	33590100
UniProt	P04908\|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)