Structure of PDB 6j6q Chain a

Receptor sequence
>6j6qa (length=84) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL
3D structure
PDB6j6q Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
Chaina
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a F65 K66 K67 R69 F38 K39 K40 R42
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6q, PDBe:6j6q, PDBj:6j6q
PDBsum6j6q
PubMed30879786
UniProtP40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)

[Back to BioLiP]