Structure of PDB 6j6g Chain a

Receptor sequence

>6j6ga (length=84) Species: 559292 (Saccharomyces cerevisiae S288C)

NTLYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSMNFKKQRGQAFITMR
TIDQASLAQISLNGERFFGKPLKVEFSKSETKTL

3D structure

• PDB: 6j6g Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
• Chain: a
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	F65 K66 K67 R69	F38 K39 K40 R42

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030620 U2 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6j6g, PDBe:6j6g, PDBj:6j6g
• PDBsum: 6j6g
• PubMed: 30879786
• UniProt: P40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)