Structure of PDB 6i9r Chain a

Receptor sequence
>6i9ra (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
TYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPHLEEGPMI
EQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
3D structure
PDB6i9r Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
Chaina
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna a K120 H121 Y124 P125 H126 G127 R128 Y129 H130 K134 K61 H62 Y65 P66 H67 G68 R69 Y70 H71 K75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i9r, PDBe:6i9r, PDBj:6i9r
PDBsum6i9r
PubMed33910005
UniProtQ9Y6G3|RM42_HUMAN Large ribosomal subunit protein mL42 (Gene Name=MRPL42)

[Back to BioLiP]