Structure of PDB 6g5h Chain a

Receptor sequence

>6g5ha (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRF
R

3D structure

PDB

6g5h Visualizing late states of human 40S ribosomal subunit maturation.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	T2 K3 K4 R5 R6 N7 N8 G9 R10 K12 K13 R15 G16 H17 Q19 P20 K32 K37 K38 F39 I41 Y68 V75 S76 I79 H80 K82 V83 V84 R85 R87 S88 R92 R95 P97 P98 R100	T1 K2 K3 R4 R5 N6 N7 G8 R9 K11 K12 R14 G15 H16 Q18 P19 K31 K36 K37 F38 I40 Y67 V74 S75 I78 H79 K81 V82 V83 R84 R86 S87 R91 R94 P96 P97 R99
BS02	ZN	a	C26 C77	C25 C76

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033119	negative regulation of RNA splicing

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:0098556	cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6g5h, PDBe:6g5h, PDBj:6g5h
PDBsum	6g5h
PubMed	29875412
UniProt	P62854\|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)