Structure of PDB 5xy3 Chain a

Receptor sequence

>5xy3a (length=149) Species: 5722 (Trichomonas vaginalis) [Search protein sequence]

PTRFHKSRKLRGQVSMGFGRVGKHRVSPGGHGRAGGQHHQRTWFDRFHPG
YFGKVGMRHLHLMKNRADEYEPTINVDKLWTLVPEEVRVKAAAAKKGDAV
PVIDCVQNGFFKVLARGELPKIPFVVRAKDFSEEAEKKIKAAGGVCEKV

3D structure

PDB

5xy3 Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 T3 R4 H6 K7 S8 R9 K10 R12 G13 V15 M17 G18 F19 G20 R21 V22 G23 H25 R26 S28 P29 G30 G31 H32 G33 R34 G36 H40 Q41 R42 T43 W44 R47 Y52 F53 G54 K55 G57 M58 R59 H60 L61 H62 L63 N66 R67 T74 N76 K113 L115 A116 S133 E134 E135	P1 T2 R3 H5 K6 S7 R8 K9 R11 G12 V14 M16 G17 F18 G19 R20 V21 G22 H24 R25 S27 P28 G29 G30 H31 G32 R33 G35 H39 Q40 R41 T42 W43 R46 Y51 F52 G53 K54 G56 M57 R58 H59 L60 H61 L62 N65 R66 T73 N75 K112 L114 A115 S132 E133 E134

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xy3, PDBe:5xy3, PDBj:5xy3
PDBsum	5xy3
PubMed	28809395
UniProt	A2DHU7

[Back to BioLiP]