Structure of PDB 5xnm Chain a

Receptor sequence

>5xnma (length=334) Species: 3888 (Pisum sativum) [Search protein sequence]

ENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGG
PYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADIINRANLGMEVMHERNAHNFPLDLA

3D structure

PDB

5xnm Structure and assembly mechanism of plant C2S2M2-type PSII-LHCII supercomplex

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	OEX	a	D170 E189 H332 E333 H337 D342 A344	D160 E179 H322 E323 H327 D332 A334
BS02	FE2	a	H215 H272	H205 H262
BS03	CLA	a	F119 P150 A153 M183 F186 I192 L193 H198 G201 V202 T286 I290	F109 P140 A143 M173 F176 I182 L183 H188 G191 V192 T276 I280
BS04	CLA	a	T45 F48 F119 V157 M172 T179 F180 M183	T35 F38 F109 V147 M162 T169 F170 M173
BS05	CLA	a	M199 V202 A203	M189 V192 A193
BS06	PHO	a	L41 A44 T45 F48 F119 Y126 E130 A146 Y147 P150 F158 L174 G175 P279 I283	L31 A34 T35 F38 F109 Y116 E120 A136 Y137 P140 F148 L164 G165 P269 I273
BS07	PHO	a	F206 S209 L210 M214 I259	F196 S199 L200 M204 I249
BS08	CLA	a	L36 P39 T40 T43 F93 P95 I96 W97 L114 L117 H118 L121	L26 P29 T30 T33 F83 P85 I86 W87 L104 L107 H108 L111
BS09	CLA	a	F33 L120 L121 M127 G128 W131	F23 L110 L111 M117 G118 W121
BS10	BCT	a	H215 Y246 H272	H205 Y236 H262

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xnm, PDBe:5xnm, PDBj:5xnm
PDBsum	5xnm
PubMed	28839073
UniProt	P06585\|PSBA_PEA Photosystem II protein D1 (Gene Name=psbA)

[Back to BioLiP]