Structure of PDB 5umd Chain a

Receptor sequence

>5umda (length=106) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

AQRVHYRRHNHYNTKSNKVRPVRTPGGKLTIHVVKKKAGKPKCADCKTAI
QGVKALRPADNYRARRKNRTVARAYGGSICARCIRERIMRAFLFEEQKCV
RQVLKE

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	A2 R4 V5 H6 Y7 R8 R9 H10 N11 H12 Y13 N14 T15 K16 S17 K19 R21 P22 V23 R24 T25 P26 G27 L30 T31 H33 K36 K37 K38 A39 G40 K41 K43 A45 Q52 G53 V54 K55 A56 R58 P59 A60 N62 Y63 R64 R66 R67 K68 N69 R70 T71 V72 A73 R74 A75 Y76 G78 A82 R83 R91 A92 E96 K99	A1 R3 V4 H5 Y6 R7 R8 H9 N10 H11 Y12 N13 T14 K15 S16 K18 R20 P21 V22 R23 T24 P25 G26 L29 T30 H32 K35 K36 K37 A38 G39 K40 K42 A44 Q51 G52 V53 K54 A55 R57 P58 A59 N61 Y62 R63 R65 R66 K67 N68 R69 T70 V71 A72 R73 A74 Y75 G77 A81 R82 R90 A91 E95 K98

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links