Structure of PDB 5mdx Chain a

Receptor sequence

>5mdxa (length=330) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

ESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGG
PYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADIINRANLGMEVMHERNAHNFP

3D structure

PDB

5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	a	R27 R238 F239	R17 R228 F229
BS02	FE2	a	H215 H272	H205 H262
BS03	CLA	a	A153 M183 Q187 I192 H198 V202 T286 I290	A143 M173 Q177 I182 H188 V192 T276 I280
BS04	CLA	a	M199 V202	M189 V192
BS05	PHO	a	Y126 E130 Y147 I283	Y116 E120 Y137 I273
BS06	CLA	a	L36 P39 T40 T43 F93 P95 W97 L114 H118	L26 P29 T30 T33 F83 P85 W87 L104 H108
BS07	CLA	a	V157 M172 I176 M183	V147 M162 I166 M173
BS08	PHO	a	L210 M214	L200 M204

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0016682	oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009635	response to herbicide
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction
GO:0051238	sequestering of metal ion

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009536	plastid
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum	5mdx
PubMed	28604725
UniProt	P83755\|PSBA_ARATH Photosystem II protein D1 (Gene Name=psbA)

[Back to BioLiP]