Structure of PDB 5it9 Chain a

Receptor sequence

>5it9a (length=100) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAI
RDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQR

3D structure

PDB

5it9 Structural characterization of ribosome recruitment and translocation by type IV IRES.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	M1 P2 K3 K4 R5 S7 N8 R10 K12 K13 G14 R15 G16 H17 K19 R28 K37 R38 K70 H72 I75 S76 I79 H80 I83 V84 R85 R87 S88 R89 R92 R93 R95 P98 R100	M1 P2 K3 K4 R5 S7 N8 R10 K12 K13 G14 R15 G16 H17 K19 R28 K37 R38 K70 H72 I75 S76 I79 H80 I83 V84 R85 R87 S88 R89 R92 R93 R95 P98 R100
BS02	ZN	a	C23 C26 C74 C77	C23 C26 C74 C77

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links