Structure of PDB 5it7 Chain a

Receptor sequence

>5it7a (length=100) Species: 28985 (Kluyveromyces lactis)

MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAI
RDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQR

3D structure

• PDB: 5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
• Chain: a
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	M1 P2 K3 K4 R5 A6 S7 N8 R10 K12 K13 R15 G16 H17 K19 R28 K32 K34 K37 I41 K70 I75 S76 I79 H80 I83 V84 R85 R87 S88 R89 R92 R93 R95 P98 R100	M1 P2 K3 K4 R5 A6 S7 N8 R10 K12 K13 R15 G16 H17 K19 R28 K32 K34 K37 I41 K70 I75 S76 I79 H80 I83 V84 R85 R87 S88 R89 R92 R93 R95 P98 R100
BS02	ZN	a	C23 C26 C74 C77	C23 C26 C74 C77
BS03	MG	a	G16 H17	G16 H17

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5it7, PDBe:5it7, PDBj:5it7
• PDBsum: 5it7
• PubMed: 27159451
• UniProt: Q6CS01