Structure of PDB 5a2q Chain a

Receptor sequence

>5a2qa (length=101) Species: 9606 (Homo sapiens)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCVIHSKVVRNRSREARKDRTPPPRF
R

3D structure

• PDB: 5a2q Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
• Chain: a
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	T2 K3 K4 R5 R6 N7 G9 R10 K12 K13 G14 R15 G16 H17 R28 K32 K34 K37 K38 F39 V75 S76 I79 K82 V83 V84 R85 N86 R87 S88 R89 R92 K93 R95 P97 P98 R100 F101	T1 K2 K3 R4 R5 N6 G8 R9 K11 K12 G13 R14 G15 H16 R27 K31 K33 K36 K37 F38 V74 S75 I78 K81 V82 V83 R84 N85 R86 S87 R88 R91 K92 R94 P96 P97 R99 F100
BS02	rna	a	E46 A47	E45 A46
BS03	ZN	a	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5a2q, PDBe:5a2q, PDBj:5a2q
• PDBsum: 5a2q
• PubMed: 26155016
• UniProt: P62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)