Structure of PDB 4d61 Chain a

Receptor sequence

>4d61a (length=96) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTP

3D structure

PDB

4d61 Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.

Chain

Resolution

9.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	T2 K3 K4 R5 R6 N8 G9 R10 A11 K12 K13 G14 R15 G16 H17 Q19 I21 K32 K34 K37 K38 F39 I41 K70 I79 V84 R85 N86 R87 S88 R92 R95 T96 P97	T1 K2 K3 R4 R5 N7 G8 R9 A10 K11 K12 G13 R14 G15 H16 Q18 I20 K31 K33 K36 K37 F38 I40 K69 I78 V83 R84 N85 R86 S87 R91 R94 T95 P96

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4d61, PDBe:4d61, PDBj:4d61
PDBsum	4d61
PubMed	25601755
UniProt	G1TFE8\|RS26_RABIT Small ribosomal subunit protein eS26 (Gene Name=RPS26)