Structure of PDB 3jap Chain a

Receptor sequence

>3japa (length=98) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

PKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIR
DLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQ

3D structure

PDB

3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.

Chain

Resolution

4.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	a	P2 K3 K4 R5 S7 N8 G9 R10 N11 K13 G14 R15 G16 H17 K19 R28 K32 K34 K37 R38 K70 I75 S76 V84 R85 R87 S88 R89 R92 R93 R95	P1 K2 K3 R4 S6 N7 G8 R9 N10 K12 G13 R14 G15 H16 K18 R27 K31 K33 K36 R37 K69 I74 S75 V83 R84 R86 S87 R88 R91 R92 R94
BS02	ZN	a	C23 C26 C74 C77	C22 C25 C73 C76

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links