Structure of PDB 5mrf Chain ZZ

Receptor sequence
>5mrfZZ (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PPVYRLPPLPRLKVKKPIIRQEANKCLVLMSNLLQCWSSYGHMSPKCAGL
VTELKSCTSESALGKRKSNINYHAARLYDRINGKPHD
3D structure
PDB5mrf The structure of the yeast mitochondrial ribosome.
ChainZZ
Resolution4.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ZZ R9 P12 L13 P14 R15 V18 K19 K20 P21 I22 R24 K75 I78 N79 Y80 P93 R5 P8 L9 P10 R11 V14 K15 K16 P17 I18 R20 K67 I70 N71 Y72 P85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mrf, PDBe:5mrf, PDBj:5mrf
PDBsum5mrf
PubMed28154081
UniProtO75012|MRP10_YEAST Small ribosomal subunit protein mS37 (Gene Name=MRP10)

[Back to BioLiP]