Structure of PDB 6sv4 Chain ZD

Receptor sequence

>6sv4ZD (length=209) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
QGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEYFAAQA

3D structure

PDB

6sv4 RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ZD	R3 R4 P5 R7 C8 Y9 K13 N14 K15 P16 Y22 Y34 K40 S61 E63 A64 A67 K74 H92 F94 R98 I99 M115 R116 A118 W119 R153 R154 Y157 K158 P160 D193 G194 K198	R2 R3 P4 R6 C7 Y8 K12 N13 K14 P15 Y21 Y33 K39 S60 E62 A63 A66 K73 H91 F93 R97 I98 M103 R104 A106 W107 R141 R142 Y145 K146 P148 D181 G182 K186
BS02	rna	ZD	Y11 E56 L57 K202 K203 L206 F217	Y10 E55 L56 K190 K191 L194 F205

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6sv4, PDBe:6sv4, PDBj:6sv4
PDBsum	6sv4
PubMed	32203490
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]