Structure of PDB 5j4d Chain ZC

Receptor sequence

>5j4dZC (length=122) Species: 262724 (Thermus thermophilus HB27)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK

3D structure

• PDB: 5j4d Structural Basis for Translation Termination on a Pseudouridylated Stop Codon.
• Chain: ZC
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	ZC	P5 T6 N8 Q9 R12 R15 E16 K23 A30 P31 F32 R33 R34 K46 K47 P48 N49 S50 L52 R53 K54 T61 Y69 P71 G72 E73 L84 R86 G87 K91 X92 V104 R113 K114 K115 S116 R117 S118 K119 G121 T122 K123 K124	P1 T2 N4 Q5 R8 R11 E12 K19 A26 P27 F28 R29 R30 K42 K43 P44 N45 S46 L48 R49 K50 T57 Y65 P67 G68 E69 L80 R82 G83 K87 X88 V100 R109 K110 K111 S112 R113 S114 K115 G117 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5j4d, PDBe:5j4d, PDBj:5j4d
• PDBsum: 5j4d
• PubMed: 27107638
• UniProt: P61941|RS12_THET2 Small ribosomal subunit protein uS12 (Gene Name=rpsL)