Structure of PDB 6b4v Chain ZB

Receptor sequence
>6b4vZB (length=107) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVR
VSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA
KCGGALD
3D structure
PDB6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
ChainZB
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ZB M1 R2 K4 H6 K8 K9 G18 K19 K21 V30 P32 K33 Y35 K47 A48 V49 R50 V51 G59 F60 K63 S70 K71 R73 R84 R86 K87 K95 M1 R2 K4 H6 K8 K9 G18 K19 K21 V30 P32 K33 Y35 K47 A48 V49 R50 V51 G59 F60 K63 S70 K71 R73 R84 R86 K87 K95
BS02 ZN ZB C99 C102 C99 C102
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
PDBsum6b4v
PubMed29366636
UniProtQ72I15|RL24_THET2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]