Structure of PDB 8wql Chain Z1 |
>8wqlZ1 (length=60) Species: 153964 (Arthrospira sp. FACHB-439) [Search protein sequence] |
TLLFQVLLAALVIVSFLMIVAVPVAYASPQNWSQSKPLIFIGSGLWAVLV ILVGVFNYLV |
|
PDB | 8wql Structure of in situ PBS-PSII supercomplex at 3.5 Angstroms resolution. |
Chain | Z1 |
Resolution | 3.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
Z1 |
I20 P24 |
I19 P23 |
|
|
|