Structure of PDB 7pin Chain Z1 |
>7pinZ1 (length=61) Species: 3046 (Dunaliella salina) [Search protein sequence] |
MTSILQIALLGLVLVSFALVVGVPVVFASPNGWTENKGVVFSGLSVWFLL VFAVGVFNSFA |
|
PDB | 7pin Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes. |
Chain | Z1 |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
Z1 |
V20 P24 |
V20 P24 |
|
|
|
|