Structure of PDB 6gzx Chain Z1 |
>6gzxZ1 (length=63) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRY |
|
PDB | 6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism. |
Chain | Z1 |
Resolution | 4.57 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Z1 |
K2 E3 H6 |
K2 E3 H6 |
|
|
|
|