Structure of PDB 8wic Chain Z

Receptor sequence

>8wicZ (length=77) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

SRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTL
FALAPGAVEFGAKRGRKTVNIVPVARP

3D structure

• PDB: 8wic Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: Z
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	S10 R11 N12 R14 S16 A18 Q19 R20 F26 G27 Q29 K32 A33 G34 E35 I36 R39 R41 G42 T43 H44 G54 G55 D56 D57 F60 P64 F69 R73 R75 R85	S1 R2 N3 R5 S7 A9 Q10 R11 F17 G18 Q20 K23 A24 G25 E26 I27 R30 R32 G33 T34 H35 G45 G46 D47 D48 F51 P55 F60 R64 R66 R76
BS02	rna	Z	K72 G74	K63 G65

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wic, PDBe:8wic, PDBj:8wic
• PDBsum: 8wic
• PubMed: 38245551
• UniProt: A0R150|RL27_MYCS2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)