Structure of PDB 8wi7 Chain Z

Receptor sequence
>8wi7Z (length=76) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
RNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTLF
ALAPGAVEFGAKRGRKTVNIVPVARP
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
ChainZ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R11 N12 R14 S16 A18 Q19 R20 K24 F26 G27 Q29 K32 A33 G34 I36 R39 R41 G42 T43 H44 F45 G54 G55 D56 D57 F60 P64 R73 R75 R85 R1 N2 R4 S6 A8 Q9 R10 K14 F16 G17 Q19 K22 A23 G24 I26 R29 R31 G32 T33 H34 F35 G44 G45 D46 D47 F50 P54 R63 R65 R75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0R150|RL27_MYCS2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]