Structure of PDB 8p2h Chain Z

Receptor sequence

>8p2hZ (length=79) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

VSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGD
DTLFAKIDGVVKFERKGRDKKQVSVYAVA

3D structure

• PDB: 8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
• Chain: Z
• Resolution: 2.49 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	S17 T18 N20 R22 D23 S24 E25 S26 K27 R28 L29 K32 R33 A34 D35 G36 Q37 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 I53 Y54 G62 G63 D64 D65 T66 F68 F77 K84 K85	S3 T4 N6 R8 D9 S10 E11 S12 K13 R14 L15 K18 R19 A20 D21 G22 Q23 G27 G28 S29 I30 Y32 R33 R35 G36 T37 K38 I39 Y40 G48 G49 D50 D51 T52 F54 F63 K70 K71
BS02	rna	Z	R79 R82	R65 R68

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
• PDBsum: 8p2h
• PubMed: 38902339
• UniProt: Q2FXT0|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)