Structure of PDB 8p2f Chain Z

Receptor sequence

>8p2fZ (length=84) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

ASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENV
GRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVA

3D structure

PDB

8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.44 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	S11 K12 S17 T18 N20 R22 D23 S24 E25 S26 K27 R28 L29 K32 R33 A34 D35 Q37 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 Y54 G62 G63 D64 D65 T66 F68 F77 K85	S2 K3 S8 T9 N11 R13 D14 S15 E16 S17 K18 R19 L20 K23 R24 A25 D26 Q28 G32 G33 S34 I35 Y37 R38 R40 G41 T42 K43 Y45 G53 G54 D55 D56 T57 F59 F68 K76
BS02	rna	Z	R79 R82	R70 R73

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum	8p2f
PubMed	38902339
UniProt	Q2FXT0\|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)