Structure of PDB 8ovj Chain Z

Receptor sequence

>8ovjZ (length=145) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SHSVDLQWVLVRQNSRFLQKRGGIRMSNDPFNNNGNWTKRHCGFLNEKAA
VVKPAKGGAICVTVKDGSSNNKPRQTYKKTVHAAGVRASDVSRAVAAVRP
DLADVSFRRARRMACIASRTAKVAAARKARSEKIKFSRKSARAKR

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R13 Q14 K21 G24 I25 R26 P31 N35 N37 R41 P55 G86 R88 A89 S90 R94 D102 D105 V106 F108 R109 R112 A115 C116 R128 K129 R131 S132 F137 S138 R139 K140 S141 R143 R146	R12 Q13 K20 G23 I24 R25 P30 N34 N36 R40 P54 G85 R87 A88 S89 R93 D101 D104 V105 F107 R108 R111 A114 C115 R127 K128 R130 S131 F136 S137 R138 K139 S140 R142 R145

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

External links