Structure of PDB 8iwh Chain Z |
>8iwhZ (length=61) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence] |
MITALTALFVLVSLALVVTVPVALATPGEWETSKDQFNKIFQLWVGLVVA IATADGISTAI |
|
PDB | 8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII |
Chain | Z |
Resolution | 2.68 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
Z |
T53 G56 I57 |
T53 G56 I57 |
|
|
|
|