Structure of PDB 8eui Chain Z

Receptor sequence
>8euiZ (length=134) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
KILKPGKVALITRGRFAGKKVVILQAIDQGSKSHPFGHAVVAGVERYPLK
VTKSMGAKRIARRSRVKPFIKVVNYNHLMPTRYALELDNLKGLITADTFK
EPTQRSAARKTVKKTFEEKYQSGKSAWFFTPLRF
3D structure
PDB8eui Chromatin localization of nucleophosmin organizes ribosome biogenesis.
ChainZ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R15 G16 R17 H36 F38 R48 K52 T54 K55 S56 M57 R61 R64 R65 R67 K69 K73 V74 N76 N78 H79 R107 K115 R135 F136 R13 G14 R15 H34 F36 R46 K50 T52 K53 S54 M55 R59 R62 R63 R65 K67 K71 V72 N74 N76 H77 R105 K113 R133 F134
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eui, PDBe:8eui, PDBj:8eui
PDBsum8eui
PubMed36423630
UniProtO14388|RL27A_SCHPO Large ribosomal subunit protein eL27A (Gene Name=rpl2701)

[Back to BioLiP]