Structure of PDB 8csu Chain Z |
>8csuZ (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] |
LSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYP NHHTYAELMQTLRFLGLYR |
|
PDB | 8csu Principles of mitoribosomal small subunit assembly in eukaryotes. |
Chain | Z |
Resolution | 3.03 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Z |
K29 K32 |
K26 K29 |
|
|
|
|