Structure of PDB 8cq7 Chain Z

Receptor sequence

>8cq7Z (length=143) Species: 5476 (Candida albicans) [Search protein sequence]

GKGKPRGLNSARKLRVHRRNNRWADQAYKARLLGTAFKSSPFGGSSHAKG
IVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRRGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR

3D structure

PDB

8cq7 Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.2 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	G2 K3 G4 K5 P6 R7 G8 N10 R13 K14 R19 R20 N22 R23 W24 A25 R32 L33 F38 K39 S46 S47 H48 A49 K50 K62 N65 S66 A67 I68 R69 K70 P88 N89 D90 G91 L103 G106 G108 R109 R110 K112 K114 G115 D116 K126 S131 K139 K140	G1 K2 G3 K4 P5 R6 G7 N9 R12 K13 R18 R19 N21 R22 W23 A24 R31 L32 F37 K38 S45 S46 H47 A48 K49 K61 N64 S65 A66 I67 R68 K69 P87 N88 D89 G90 L102 G105 G107 R108 R109 K111 K113 G114 D115 K125 S130 K138 K139
BS02	MG	Z	E101 G129	E100 G128

External links