Structure of PDB 8buu Chain Z

Receptor sequence
>8buuZ (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVS
HLVSVKEQ
3D structure
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
ChainZ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R10 S11 I13 G14 R15 P16 E17 V21 T22 R24 T25 K29 K30 T31 N32 H37 N40 A42 I43 G45 M46 K49 R9 S10 I12 G13 R14 P15 E16 V20 T21 R23 T24 K28 K29 T30 N31 H36 N39 A41 I42 G44 M45 K48
BS02 rna Z Q19 H52 Q18 H51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP19947|RL30_BACSU Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]