Structure of PDB 8bqd Chain Z

Receptor sequence

>8bqdZ (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

8bqd The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R18 N24 D25 F27 H29 K36 T38 R41 T43 G45 M46 D51 R52 E54 P122 S123 D124 S125 T126 R127 K129 G130 R132 R133 R135 R136	R8 N14 D15 F17 H19 K26 T28 R31 T33 G35 M36 D41 R42 E44 P112 S113 D114 S115 T116 R117 K119 G120 R122 R123 R125 R126

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8bqd, PDBe:8bqd, PDBj:8bqd
PDBsum	8bqd
PubMed	37079644
UniProt	P06367\|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)