Structure of PDB 8b3s Chain Z |
>8b3sZ (length=147) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
IDPFTMMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGI AAKALQALGLGSEKIQKEVESLIGRGQEMSQTIHYTPRAKKVIELSMDEA RKLGHSYVGTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLL |
|
PDB | 8b3s Structure of YjbA in complex with ClpC N-terminal Domain |
Chain | Z |
Resolution | 2.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
Z |
T7 T105 |
T12 T110 |
|
|
|