Structure of PDB 8azw Chain Z

Receptor sequence

>8azwZ (length=98) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

VNVPKTKKTYCKSKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKG

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	V2 N3 P5 K8 K9 T10 Y11 K19 H20 Y28 K30 G31 D33 S34 A36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G51 G52 Q53 K55 P56 V57 F58 K60 A62 K63 T65 K67 V69 R71 H79 V80 Q82 H83 P84 K86 R87 C88 K89 K97 K98	V1 N2 P4 K7 K8 T9 Y10 K18 H19 Y27 K29 G30 D32 S33 A35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G50 G51 Q52 K54 P55 V56 F57 K59 A61 K62 T64 K66 V68 R70 H78 V79 Q81 H82 P83 K85 R86 C87 K88 K96 K97
BS02	ZN	Z	C12 C74 C77	C11 C73 C76

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links