Structure of PDB 8aag Chain Z

Receptor sequence
>8aagZ (length=73) Species: 8355 (Xenopus laevis) [Search protein sequence]
HPKYSDMILAAVQAEKSRSGSSRQSIQKYIKNHYKVGENADSQIKLSIKR
LVTSGALKQTKGVGASGSFRLAK
3D structure
PDB8aag Nucleosome dyad determines the H1 C-terminus collapse on distinct DNA arms.
ChainZ
Resolution10.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Z Q48 Q51 N63 Q24 Q27 N39
BS02 dna Z H25 K27 Q67 R74 H1 K3 Q43 R50
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8aag, PDBe:8aag, PDBj:8aag
PDBsum8aag
PubMed36610392
UniProtP22844|H10B_XENLA Histone H1.0-B (Gene Name=h1-0-b)

[Back to BioLiP]