Structure of PDB 7uvz Chain Z

Receptor sequence
>7uvzZ (length=54) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
AVQQNRKSRSRRDMRRSHDALTENALTVDQATGETHRRHHVTKDGFYRGR
QLFA
3D structure
PDB7uvz Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainZ
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z A2 V3 Q4 Q5 N6 R7 K8 R10 S11 R12 R13 D14 M15 R16 R17 S18 H19 T28 Q31 R39 H40 Y48 R49 A1 V2 Q3 Q4 N5 R6 K7 R9 S10 R11 R12 D13 M14 R15 R16 S17 H18 T27 Q30 R38 H39 Y47 R48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvz, PDBe:7uvz, PDBj:7uvz
PDBsum7uvz
PubMed37192172
UniProtB7I7A4|RL32_ACIB5 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]