Structure of PDB 7ttu Chain Z

Receptor sequence
>7ttuZ (length=121) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
GYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLG
KKGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYT
RILKQGPRRGDGAESVIIELV
3D structure
PDB7ttu A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainZ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z G2 R4 K5 L6 G7 S10 Q12 I30 T32 T33 A35 R36 E39 S42 E45 K46 R59 R60 Q83 R96 Q97 G98 R102 R109 R110 D112 G1 R3 K4 L5 G6 S9 Q11 I29 T31 T32 A34 R35 E38 S41 E44 K45 R58 R59 Q82 R95 Q96 G97 R101 R108 R109 D111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttu, PDBe:7ttu, PDBj:7ttu
PDBsum7ttu
PubMed35736238
UniProtQ2FW33|RL17_STAA8 Large ribosomal subunit protein bL17 (Gene Name=rplQ)

[Back to BioLiP]