Structure of PDB 7rf7 Chain Z |
>7rf7Z (length=62) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] |
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL VLVVGVLNFFVV |
|
PDB | 7rf7 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition. |
Chain | Z |
Resolution | 2.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Z |
F17 A28 D32 |
F17 A28 D32 |
|
|
|
|