Structure of PDB 7r3k Chain Z

Receptor sequence

>7r3kZ (length=194) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRW
AMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFE
FVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLA
MVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

3D structure

PDB

7r3k Structure of Photosystem I Supercomplex Isolated from a Chlamydomonas reinhardtii Cytochrome b6f Temperature-Sensitive Mutant.

Chain

Resolution

2.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	Z	R79 M82 L83 Y149 P150 F154 F159 A160 L169 K170 E173	R49 M52 L53 Y119 P120 F124 F129 A130 L139 K140 E143
BS02	CLA	Z	K172 N176 L179	K142 N146 L149
BS03	CLA	Z	V182 G186 A189 Q190 A201 E204 H205 N213 F214 N217	V152 G156 A159 Q160 A171 E174 H175 N183 F184 N187
BS04	CLA	Z	L45 L49 G51 N52 Y53 F55 D56 L60 G61 L67 F70 T71 E74 H77 R178 M181 V182	L15 L19 G21 N22 Y23 F25 D26 L30 G31 L37 F40 T41 E44 H47 R148 M151 V152
BS05	CLA	Z	R79 W80 A137 Q140 R141 F154	R49 W50 A107 Q110 R111 F124
BS06	CLA	Z	H205 P209 W210 N213 F214	H175 P179 W180 N183 F184
BS07	CLA	Z	R69 F70 H77	R39 F40 H47
BS08	CHL	Z	W35 L36 P37 Y53 F55	W5 L6 P7 Y23 F25
BS09	CHL	Z	Y100 P103 L104 E130	Y70 P73 L74 E100
BS10	CLA	Z	W80 G87 V91 Y96 T113 W114 F115	W50 G57 V61 Y66 T83 W84 F85
BS11	CLA	Z	L171 K172 K175 N176	L141 K142 K145 N146
BS12	CHL	Z	W105 L126 F129 E130	W75 L96 F99 E100
BS13	CLA	Z	F214 S220 P222	F184 S190 P192
BS14	CLA	Z	E72 S73 I76 H77 W80 M134 A135 E138 R141	E42 S43 I46 H47 W50 M104 A105 E108 R111

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r3k, PDBe:7r3k, PDBj:7r3k
PDBsum	7r3k
PubMed	36979472
UniProt	Q05093

[Back to BioLiP]