Structure of PDB 7qv2 Chain Z

Receptor sequence
>7qv2Z (length=58) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVS
HLVSVKEQ
3D structure
PDB7qv2 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
ChainZ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z R15 H52 R14 H51
BS02 rna Z R10 S11 I13 G14 R15 P16 E17 T25 K29 K30 T31 N32 E38 A42 M46 R9 S10 I12 G13 R14 P15 E16 T24 K28 K29 T30 N31 E37 A41 M45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qv2, PDBe:7qv2, PDBj:7qv2
PDBsum7qv2
PubMed35264791
UniProtP19947|RL30_BACSU Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]