Structure of PDB 7q5b Chain Z

Receptor sequence
>7q5bZ (length=289) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGR
RSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHI
TELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRP
AGIAGACILLACRMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKL
SVQKFRENDVEDGEARPPSFVKNRKKERKIPRNLHLLPTTDTYLSKVSDD
PDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLE
3D structure
PDB7q5b Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
ChainZ
Resolution3.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Z V117 Q118 R120 R218 R219 V250 A251 E253 T254 S289 N293 V47 Q48 R50 R148 R149 V180 A181 E183 T184 S219 N223
BS02 dna Z S75 R76 T79 F116 G119 R120 R121 Y155 E253 S5 R6 T9 F46 G49 R50 R51 Y85 E183
Gene Ontology
Molecular Function
GO:0000994 RNA polymerase III core binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001156 TFIIIC-class transcription factor complex binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006352 DNA-templated transcription initiation
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070897 transcription preinitiation complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q5b, PDBe:7q5b, PDBj:7q5b
PDBsum7q5b
PubMed34848735
UniProtP29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit (Gene Name=BRF1)

[Back to BioLiP]