Structure of PDB 7pzy Chain Z

Receptor sequence

>7pzyZ (length=132) Species: 237561 (Candida albicans SC5314)

DAVTIRTRKVISNPLLARRQFVIDVLHPNRANVSKDELREKLAEIYKAEK
DAVSVFGFRTQFGGGKSTGFGLIYQSVADAKRFEPAYRLVRYGLAEKVEK
ASRQQRKQKKNRDKKIFGTQRRAQKRAARRNA

3D structure

• PDB: 7pzy E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: Z
• Resolution: 2.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	R8 T9 R10 K11 V12 R21 A33 N34 S36 K37 Y48 F60 R61 T62 Q63 F64 G65 Y89 R93 R105 Q106 R108 K109 Q110 K112 N113 K116 K117 F119 G120 T121 R123 R124 R128	R6 T7 R8 K9 V10 R19 A31 N32 S34 K35 Y46 F58 R59 T60 Q61 F62 G63 Y87 R91 R103 Q104 R106 K107 Q108 K110 N111 K114 K115 F117 G118 T119 R121 R122 R126

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pzy, PDBe:7pzy, PDBj:7pzy
• PDBsum: 7pzy
• PubMed: 35613268
• UniProt: Q5A7K0|RS24_CANAL Small ribosomal subunit protein eS24 (Gene Name=RPS24)