Structure of PDB 7po2 Chain Z

Receptor sequence
>7po2Z (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
SLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWY
PNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRA
3D structure
PDB7po2 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainZ
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z K29 K32 H56 Q63 F67 H75 M79 Q82 R89 K91 K93 P94 K96 K100 R101 K27 K30 H54 Q61 F65 H73 M77 Q80 R87 K89 K91 P92 K94 K98 R99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po2, PDBe:7po2, PDBj:7po2
PDBsum7po2
PubMed35676484
UniProtQ9Y291|RT33_HUMAN Small ribosomal subunit protein mS33 (Gene Name=MRPS33)

[Back to BioLiP]