Structure of PDB 7of7 Chain Z

Receptor sequence
>7of7Z (length=115) Species: 9606 (Homo sapiens) [Search protein sequence]
KFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKD
IIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENM
SNTCLKSTGELVVQW
3D structure
PDB7of7 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
ChainZ
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z K35 F36 T37 R38 S39 R40 R71 K73 S74 R76 R77 R78 P79 Y80 K83 M88 K93 A94 K101 S105 V106 K109 K1 F2 T3 R4 S5 R6 R37 K39 S40 R42 R43 R44 P45 Y46 K49 M54 K59 A60 K67 S71 V72 K75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of7, PDBe:7of7, PDBj:7of7
PDBsum7of7
PubMed34135319
UniProtQ8TCC3|RM30_HUMAN Large ribosomal subunit protein uL30m (Gene Name=MRPL30)

[Back to BioLiP]