Structure of PDB 7nkx Chain Z

Receptor sequence

>7nkxZ (length=156) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ATIWGVRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSIFQRDNYTGR
IYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPNLEEVALGKT
VRIRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKHKLTYYNREGGE
GITYDE

3D structure

PDB

7nkx Structural basis of nucleosome transcription mediated by Chd1 and FACT.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	Z	R293 P294	R9 P10

Gene Ontology

	Molecular Function
GO:0000993	RNA polymerase II complex binding
GO:0001042	RNA polymerase I core binding
GO:0001179	RNA polymerase I general transcription initiation factor binding
GO:0003677	DNA binding
GO:0003727	single-stranded RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0017070	U6 snRNA binding
GO:0019843	rRNA binding
GO:0030619	U1 snRNA binding
GO:0030620	U2 snRNA binding
GO:0030621	U4 snRNA binding
GO:0030623	U5 snRNA binding
GO:0042393	histone binding
GO:0044877	protein-containing complex binding
GO:0070990	snRNP binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0006338	chromatin remodeling
GO:0006354	DNA-templated transcription elongation
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006397	mRNA processing
GO:0008298	intracellular mRNA localization
GO:0010508	positive regulation of autophagy
GO:0032784	regulation of DNA-templated transcription elongation
GO:0032968	positive regulation of transcription elongation by RNA polymerase II
GO:0090262	regulation of transcription-coupled nucleotide-excision repair
GO:0140673	transcription elongation-coupled chromatin remodeling
GO:2000232	regulation of rRNA processing
GO:2001208	negative regulation of transcription elongation by RNA polymerase I
GO:2001209	positive regulation of transcription elongation by RNA polymerase I

	Cellular Component
GO:0000785	chromatin
GO:0005634	nucleus
GO:0005694	chromosome
GO:0005739	mitochondrion
GO:0032044	DSIF complex
GO:0032991	protein-containing complex
GO:0033553	rDNA heterochromatin
GO:0043232	intracellular non-membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nkx, PDBe:7nkx, PDBj:7nkx
PDBsum	7nkx
PubMed	33846633
UniProt	P27692\|SPT5_YEAST Transcription elongation factor SPT5 (Gene Name=SPT5)

[Back to BioLiP]