Structure of PDB 7nhn Chain Z

Receptor sequence

>7nhnZ (length=73) Species: 169963 (Listeria monocytogenes EGD-e)

SNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGTNVGRGGDDTLF
AKTDGVVRFERMGRDKKKVSVYP

3D structure

• PDB: 7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: Z
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Z	N20 R22 D23 S24 E25 S26 K27 R28 L29 K32 R33 A34 D35 G36 Q37 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 Y54 G62 G63 D64 D65 F68 F77 K85	N2 R4 D5 S6 E7 S8 K9 R10 L11 K14 R15 A16 D17 G18 Q19 G23 G24 S25 I26 Y28 R29 R31 G32 T33 K34 Y36 G44 G45 D46 D47 F50 F59 K67
BS02	rna	Z	R79 R82	R61 R64

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
• PDBsum: 7nhn
• PubMed: 34117249
• UniProt: P66125|RL27_LISMO Large ribosomal subunit protein bL27 (Gene Name=rpmA)