Structure of PDB 7nhk Chain Z

Receptor sequence
>7nhkZ (length=60) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
AKVCYFTGRKTSSGNNRSHAMNSTKRTVKPNLQKVRVLIDGKPKKVWVST
RALKSGKIER
3D structure
PDB7nhk Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
ChainZ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Z A2 K3 R10 T12 S14 N16 R18 S19 A21 M22 N23 K26 R27 K30 P31 N32 Q34 K35 K43 K46 W48 T51 R52 K55 S56 A1 K2 R9 T11 S13 N15 R17 S18 A20 M21 N22 K25 R26 K29 P30 N31 Q33 K34 K42 K45 W47 T50 R51 K54 S55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhk, PDBe:7nhk, PDBj:7nhk
PDBsum7nhk
PubMed34117249
UniProtA0A1B4XRZ8

[Back to BioLiP]