Structure of PDB 7kif Chain Z

Receptor sequence
>7kifZ (length=76) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
QRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRAEP
WGVWGGEIFDQGSIVSHKRPRGRPRK
3D structure
PDB7kif Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
ChainZ
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna Z K80 R81 R85 P86 K68 R69 R73 P74
BS02 dna Z R83 G84 R85 R87 K88 R71 G72 R73 R75 K76
BS03 SF4 Z C20 W28 C43 C46 I48 C52 W66 G67 C8 W16 C31 C34 I36 C40 W54 G55
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0035731 dinitrosyl-iron complex binding
GO:0046872 metal ion binding
GO:0047134 protein-disulfide reductase (NAD(P)H) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045454 cell redox homeostasis
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:0070542 response to fatty acid
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kif, PDBe:7kif, PDBj:7kif
PDBsum7kif
PubMed34171296
UniProtQ6MX01|WHB7A_MYCTU Probable transcriptional regulator WhiB7 (Gene Name=whiB7)

[Back to BioLiP]