Structure of PDB 7eda Chain Z

Receptor sequence
>7edaZ (length=57) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
TILFQLALAALVILSFVMVIGVPVAYASWDRSKQLIFLGSGLWIALVLVV
GVLNFFV
3D structure
PDB7eda Cryo-EM structure of monomeric photosystem II at 2.78 angstrom resolution reveals factors important for the formation of dimer.
ChainZ
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide Z F17 I21 P24 V25 A28 S29 F16 I20 P23 V24 A27 S28
BS02 CLA Z M19 P24 M18 P23
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eda, PDBe:7eda, PDBj:7eda
PDBsum7eda
PubMed34216574
UniProtD0VWR5|PSBZ_THEVL Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]